CDC6 Rabbit anti-Human, Polyclonal , Abnova™

Catalog No.	Quantity
89-933-906	100 μL

Catalog No. 89-933-906 Supplier Abnova Corporation Supplier No. PAB29498

Description

CDC6 polyclonal antibody raised against recombinant human CDC6.

The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc6, a protein essential for the initiation of DNA replication. This protein functions as a regulator at the early steps of DNA replication. It localizes in cell nucleus during cell cyle G1, but translocates to the cytoplasm at the start of S phase. The subcellular translocation of this protein during cell cyle is regulated through its phosphorylation by Cdks. Transcription of this protein was reported to be regulated in response to mitogenic signals through transcriptional control mechanism involving E2F proteins. [provided by RefSeq]

Sequence: CQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPP

Specifications

• Antigen: CDC6
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: CDC6 polyclonal antibody raised against recombinant human CDC6.
• Dilution: Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: CDC18L/HsCDC18/HsCDC6
• Gene Symbols: CDC6
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human CDC6.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 990
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG