Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CDC6 Rabbit anti-Human, Polyclonal , Abnova™

CDC6 polyclonal antibody raised against recombinant human CDC6.

Manufacturer:  Abnova Corporation PAB29498

Catalog No. 89-933-906


Add to cart

Description

Description

The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc6, a protein essential for the initiation of DNA replication. This protein functions as a regulator at the early steps of DNA replication. It localizes in cell nucleus during cell cyle G1, but translocates to the cytoplasm at the start of S phase. The subcellular translocation of this protein during cell cyle is regulated through its phosphorylation by Cdks. Transcription of this protein was reported to be regulated in response to mitogenic signals through transcriptional control mechanism involving E2F proteins. [provided by RefSeq]

Sequence: CQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTLFEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPP
Specifications

Specifications

CDC6
Unconjugated
Immunofluorescence (1-4 ug/mL) Immunohistochemistry (1:10-1:20) The optimal working dilution should be determined by the end user.
Liquid
CDC6
Recombinant protein corresponding to amino acids of human CDC6.
Antigen affinity purification
RUO
Primary
990
Immunofluorescence, Immunohistochemistry (PFA fixed)
CDC6 polyclonal antibody raised against recombinant human CDC6.
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
CDC18L/HsCDC18/HsCDC6
Rabbit
IgG
100 uL
Store at 4°C. For long term storage store at -20°C.
Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit