CDC7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB436931	Novus Biologicals NBP23270825UL	25 μL
NBP232708	Novus Biologicals NBP232708	0.1 mL

Description

CDC7 Polyclonal specifically detects CDC7 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CDC7
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: CDC7 (cell division cycle 7, S. cerevisiae, homolog)-like 1, CDC7 cell division cycle 7 (S. cerevisiae), CDC7L1MGC117361, CDC7-related kinase, cell division cycle 7 (S. cerevisiae), cell division cycle 7 homolog (S. cerevisiae), cell division cycle 7-like protein 1, cell division cycle 7-related protein kinase, EC 2.7.11.1, HsCdc7, Hsk1, huCdc7, MGC126237, MGC126238
• Gene Symbols: CDC7
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, GPCR, Stem Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 8317
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREY
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only