CDH17 Rabbit anti-Human, Polyclonal , Abnova™

Catalog No.	Quantity
89-933-917	100 μL

Catalog No. 89-933-917 Supplier Abnova Corporation Supplier No. PAB29342

Description

Rabbit polyclonal antibody raised against recombinant human CDH17.

This gene is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: INNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDP

Specifications

• Antigen: CDH17
• Applications: Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against recombinant human CDH17.
• Dilution: Immunohistochemistry (1:1000-1:2500) Western Blot (1:100-1:250) Immunofluorescence (1-4 ug/mL) The optimal working dilution should be determined by the end user.
• Formulation: In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
• Gene Alias: CDH16/FLJ26931/HPT-1/HPT1/MGC138218/MGC142024
• Gene Symbols: CDH17
• Host Species: Rabbit
• Immunogen: Recombinant protein corresponding to amino acids of human CDH17.
• Purification Method: Antigen affinity purification
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1015
• Target Species: Human
• Content And Storage: Store at 4°C. For long term storage store at -20°C.
  Aliquot to avoid repeated freezing and thawing.
• Form: Liquid
• Isotype: IgG