CDK2AP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25692425UL

Catalog No. NB403589

Description

CDK2AP1 Polyclonal specifically detects CDK2AP1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CDK2AP1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CDK2-associated protein 1cyclin-dependent kinase 2-associated protein 1, CDKAP1, cyclin-dependent kinase 2 associated protein 1, Deleted in oral cancer 1, Deleted in oral cancer-1, doc-1, DOC1Putative oral cancer suppressor, DORC1, p12DOC-1, ST19
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CDK2AP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MSYKPNLAAHMPAAALNAAGSVHSPSTSMA
• Quantity: 25 μL
• Research Discipline: Breast Cancer, Cancer
• Gene ID (Entrez): 8099
• Target Species: Human
• Form: Purified

For Research Use Only