Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDP/CUTL1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | CDP/CUTL1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
CDP/CUTL1 Polyclonal specifically detects CDP/CUTL1 in Mouse samples. It is validated for Western Blot.Specifications
| CDP/CUTL1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse | |
| CCAAT displacement protein, CDP/Cux, CDPCCAAT displacement protein, COY1, CUT, cut (Drosophila)-like 1 (CCAAT displacement protein), cut-like 1, CCAAT displacement protein (Drosophila), cut-like homeobox 1, FLJ31745, golgi integral membrane protein 6, GOLIM6, homeobox protein cut-like 1, Homeobox protein cux-1, Nbla10317, p100, p110, p200, p75, protein CASP, putative protein product of Nbla10317 | |
| The immunogen is a synthetic peptide directed towards the middle region of mouse CDP/CUTL1 (NP_001278162.1). Peptide sequence PEEKEALKRAYQQKPYPSPKTIEELATQLNLKTSTVINWFHNYRSRIRRE | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 1523 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title