CDT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25821625UL

Catalog No. NB403258

Description

CDT2 Polyclonal specifically detects CDT2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CDT2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CDT2RA-regulated nuclear matrix-associated protein, CDW1, DCAF2DDB1 and CUL4 associated factor 2, DDB1- and CUL4-associated factor 2, denticleless homolog (Drosophila), L2DTLRA regulated nuclear matrix associated protein, Lethal(2) denticleless protein homolog, RAMPdenticleless protein homolog, Retinoic acid-regulated nuclear matrix-associated protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DTL
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AGDLPLPSNTPTFSIKTSPAKARSPINRRGSVSSVSPKPPSSFKMSIRNWVTRTPSSSPPITPPASETKIMSPRKALIPVSQKSSQA
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 51514
• Target Species: Human
• Isotype: IgG

For Research Use Only