Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CDX2 Antibody, Novus Biologicals™

CDX2 Antibody, Novus Biologicals™
SDP

Catalog No. NB403248 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB403248 25 μL
NBP258280 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB403248 Supplier Novus Biologicals Supplier No. NBP25828025UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CDX2 Polyclonal specifically detects CDX2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen CDX2
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias caudal type homeo box transcription factor 2, caudal type homeobox 2, Caudal-type homeobox protein 2, CDX-3, CDX3caudal type homeobox transcription factor 2, homeobox protein CDX-2
Gene Symbols CDX2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Chromatin Research, DNA Repair, Growth and Development, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 1045
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.