Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDX2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25828025UL
Description
CDX2 Polyclonal specifically detects CDX2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
CDX2 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
caudal type homeo box transcription factor 2, caudal type homeobox 2, Caudal-type homeobox protein 2, CDX-3, CDX3caudal type homeobox transcription factor 2, homeobox protein CDX-2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
CDX2 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVA | |
25 μL | |
Cancer, Chromatin Research, DNA Repair, Growth and Development, Transcription Factors and Regulators | |
1045 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction