Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CDX4 Antibody, Novus Biologicals™

CDX4 Antibody, Novus Biologicals™
SDP

Catalog No. NB236146 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB236146 100 μg
NB239620 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB236146 Supplier Novus Biologicals Supplier No. NBP321268100UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CDX4 Polyclonal antibody specifically detects CDX4 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen CDX4
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias caudal type homeo box transcription factor 4, caudal type homeobox 4, caudal type homeobox transcription factor 4, Caudal-type homeobox protein 4, homeobox protein CDX-4
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: GSPMPASNFAAAPAFSHYMGYPHMPSMDPHWPSLGVWGSPYSPPREDWSVYPGPSSTMGTVPVNDVTSSPAAFCSTDYSNLG
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1046
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.