Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDY1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP288834100UL
Description
CDY1 Polyclonal specifically detects CDY1 in Human samples. It is validated for Western Blot.Specifications
CDY1 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
CDY, CDY1A, Chromodomain Protein, Y Chromosome, 1, Chromodomain Protein, Y-Linked, 1, Chromodomain Y-Linked 1, EC 2.3.1.48 | |
Synthetic peptides corresponding to Netrin-4 The peptide sequence was selected from the C terminal of CDY1. Peptide sequence FPRTWWQSAEDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDF. | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose | |
Rabbit | |
Protein A purified | |
RUO | |
9085 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction