Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDYL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $501.50
Specifications
| Antigen | CDYL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15517820
|
Novus Biologicals
NBP15517820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP155178
|
Novus Biologicals
NBP155178 |
100 μL |
Each for $501.50
|
|
|||||
Description
CDYL2 Polyclonal specifically detects CDYL2 in Human samples. It is validated for Western Blot.Specifications
| CDYL2 | |
| Polyclonal | |
| Rabbit | |
| Q8N8U2 | |
| 124359 | |
| Synthetic peptides corresponding to CDYL2(chromodomain protein, Y-like 2) The peptide sequence was selected from the N terminal of CDYL2 (NP_689555). Peptide sequence NPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CDY-like 2, chromodomain protein, Y-like 2, chromodomain Y-like protein 2, FLJ38866 | |
| CDYL2 | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title