Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CDYL2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
| Antigen | CDYL2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15517820
|
Novus Biologicals
NBP15517820UL |
20 μL |
Each for $152.22
|
|
NBP155178
|
Novus Biologicals
NBP155178 |
100 μL |
Each for $436.00
|
|
Description
CDYL2 Polyclonal specifically detects CDYL2 in Human samples. It is validated for Western Blot.Specifications
| CDYL2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| CDY-like 2, chromodomain protein, Y-like 2, chromodomain Y-like protein 2, FLJ38866 | |
| CDYL2 | |
| IgG | |
| Affinity Purified | |
| 57 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q8N8U2 | |
| 124359 | |
| Synthetic peptides corresponding to CDYL2(chromodomain protein, Y-like 2) The peptide sequence was selected from the N terminal of CDYL2 (NP_689555). Peptide sequence NPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title