Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CEACAM1/CD66a Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP185743

View more versions of this product

Catalog No. NBP185743

$610.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

CEACAM1/CD66a Polyclonal specifically detects CEACAM1/CD66a in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	CEACAM1/CD66a
Classification	Polyclonal
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	antigen CD66, BGP-1, BGP1BGPBiliary glycoprotein 1, BGPI, biliary glycoprotein adhesion molecule, carcinoembryonic antigen-related cell adhesion molecule 1, carcinoembryonic antigen-related cell adhesion molecule 1 (biliaryglycoprotein), CD66a, CD66a antigen
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	CEACAM1
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE
Quantity	0.1 mL
Research Discipline	Apoptosis, Cancer
Gene ID (Entrez)	634
Target Species	Human
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

CEACAM1/CD66a Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions