Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CEECAM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18455125UL
Description
CEECAM1 Polyclonal specifically detects CEECAM1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CEECAM1 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
CEECAM1, CerCAM, cerebral endothelial cell adhesion molecule 1, cerebral endothelial cell adhesion moleculeMGC149621, GLT25D3cerebral cell adhesion molecule, glycosyltransferase 25 domain containing 3, glycosyltransferase 25 family member 3, KIAA1502, MGC149620 | |
Rabbit | |
Affinity Purified | |
RUO | |
51148 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CERCAM | |
This antibody was developed against Recombinant Protein corresponding to amino acids:TFLASLRAEGADQLAFYPPHPNYTWPFDDIIVFAYACQAAGVSVHVCNEHRYGYMNVPVKSHQGLEDERVNFIHLILEALVDG | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Product Content Correction