CENPF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256124

Catalog No. NBP256124

Description

CENPF Polyclonal specifically detects CENPF in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CENPF
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: AH antigen, cell-cycle-dependent 350K nuclear protein, CENF, CENP-F, CENP-F kinetochore protein, centromere protein F, centromere protein F (350/400kD, mitosin), centromere protein F, 350/400ka (mitosin), centromere protein F, 350/400kDa (mitosin), hcp-1, Kinetochore protein CENPF, mitosin, PRO1779
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CENPF
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CISELSFSGPNALVPMDFLGNQEDIHNLQLRVKETSNENLRLLHVIEDRDRKVESLLNEMKELDSKLHLQEVQLMTKIEACIELEKIVGELKKENSDLSEKLEYFSCDHQEL
• Quantity: 100 μL
• Research Discipline: Cancer, Cell Cycle and Replication, Chromatin Research
• Gene ID (Entrez): 1063
• Target Species: Human
• Isotype: IgG

For Research Use Only