CENPI Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156364

Catalog No. NBP156364

Description

CENPI Polyclonal specifically detects CENPI in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CENPI
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CENP-IFSH primary response (LRPR1, rat) homolog 1, centromere protein I, Follicle-stimulating hormone primary response protein, FSH primary response 1, FSH primary response protein 1, FSHPRH1Mis6, ICEN19, Interphase centromere complex protein 19, Leucine-rich primary response protein 1, LRPR1FSH primary response (LRPR1 homolog, rat) 1, Mis6
• Host Species: Rabbit
• Molecular Weight of Antigen: 87 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunocytochemistry/Immunofluorescence
• Gene Accession No.: Q92674
• Gene Symbols: CENPI
• Immunogen: Synthetic peptides corresponding to CENPI(centromere protein I) The peptide sequence was selected from the N terminal of CENPI. Peptide sequence SPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2491
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.