Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CEP350 Antibody (CL3423), Novus Biologicals™

Mouse Monoclonal Antibody

$382.00 - $646.00

Specifications

Antigen	CEP350
Classification	Monoclonal
Conjugate	Unconjugated
Form	Purified
Host Species	Mouse

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP259028 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP259028	100 μL	Each for $646.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB403065 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25902825UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CEP350 Monoclonal specifically detects CEP350 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	CEP350
Conjugate	Unconjugated
Host Species	Mouse
Target Species	Human
Gene ID (Entrez)	9857
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	CAP350GM133, centrosomal protein 350kDa, centrosome-associated protein 350, Centrosome-associated protein of 350 kDa, Cep350, FLJ38282, FLJ44058, KIAA0480centrosome associated protein 350
Gene Symbols	CEP350
Isotype	IgG1
Purification Method	Protein A purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CEP350 Antibody (CL3423), Novus Biologicals™

Specifications

Description

Specifications

Documents