Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CEP350 Antibody (CL3423), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $646.00
Specifications
Antigen | CEP350 |
---|---|
Classification | Monoclonal |
Conjugate | Unconjugated |
Form | Purified |
Host Species | Mouse |
Description
CEP350 Monoclonal specifically detects CEP350 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
CEP350 | |
Unconjugated | |
Mouse | |
Human | |
9857 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QVVQSQREVTEVLQEATCKIAAQQSETARLTTDAARQICEMAELTRTHISDAVVASGAPLAILYDHQRQHLPDFVKQLRTRTETDRKSPSVSLSQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Monoclonal | |
Purified | |
RUO | |
CAP350GM133, centrosomal protein 350kDa, centrosome-associated protein 350, Centrosome-associated protein of 350 kDa, Cep350, FLJ38282, FLJ44058, KIAA0480centrosome associated protein 350 | |
CEP350 | |
IgG1 | |
Protein A purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title