Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89933959

CEP57 (19-128) Mouse anti-Human, Clone: 1E9, Abnova™

Catalog No. 89933959 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-933-959 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-933-959 Supplier Abnova Corporation Supplier No. H00009702M02
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CEP57.

Translokin binds basic fibroblast growth factor (FGF2; MIM 134920) and mediates its nuclear translocation and mitogenic activity (Bossard et al., 2003 [PubMed 12717444]).[supplied by OMIM]

Sequence: AEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQE

Specifications

Antigen CEP57 (19-128)
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 1E9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CEP57.
Formulation PBS with no preservative; pH 7.4
Gene CEP57
Gene Accession No. NM_014679
Gene Alias KIAA0092/PIG8/TSP57
Gene Symbols CEP57
Host Species Mouse
Immunogen CEP57 (NP_055494,19 a.a. ∽ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Protein A/G purification
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9702
Test Specificity Antibody Reactive Against Recombinant Protein.
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.