Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CEP57 (19-128) Mouse anti-Human, Clone: 1E9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CEP57.

Manufacturer:  Abnova Corporation H00009702M02

Catalog No. 89-933-959


Add to cart

Description

Description

Translokin binds basic fibroblast growth factor (FGF2; MIM 134920) and mediates its nuclear translocation and mitogenic activity (Bossard et al., 2003 [PubMed 12717444]).[supplied by OMIM]

Sequence: AEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQE
Specifications

Specifications

CEP57 (19-128)
Monoclonal
Unconjugated
PBS with no preservative; pH 7.4
NM_014679
KIAA0092/PIG8/TSP57
Mouse
IgG1,kappa
100 ug
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
9702
Human
ELISA, Immunofluorescence, Western Blot
1E9
Mouse monoclonal antibody raised against a partial recombinant CEP57.
CEP57
Purified
CEP57
CEP57 (NP_055494,19 a.a. ∽ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Protein A/G purification
RUO
Antibody
Monoclonal
Antibody Reactive Against Recombinant Protein.
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit