Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89933960

CEP57 (19-128) Mouse anti-Human, Polyclonal , Abnova™

Catalog No. 89933960 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-933-960 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-933-960 Supplier Abnova Corporation Supplier No. H00009702A02
Add to Cart
Add to Cart

Description

Mouse polyclonal antibody raised against a partial recombinant CEP57.

Translokin binds basic fibroblast growth factor (FGF2; MIM 134920) and mediates its nuclear translocation and mitogenic activity (Bossard et al., 2003 [PubMed 12717444]).[supplied by OMIM]

Sequence: AEPSRSNGSMVRHSSSPYVVYPSDKPFLNSDLRRSPSKPTLAYPESNSRAIFSALKNLQDKIRRLELERIQAEESVKTLSRETIEYKKVLDEQIQERENSKNEESKHNQE

Specifications

Antigen CEP57 (19-128)
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant CEP57.
Formulation 50% glycerol
Gene Accession No. NM_014679
Gene Alias KIAA0092/PIG8/TSP57
Gene Symbols CEP57
Host Species Mouse
Immunogen CEP57 (NP_055494, 19 a.a. ∽ 128 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9702
Test Specificity Antibody Reactive Against Recombinant Protein.
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.