Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CES7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CES7 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CES7 Polyclonal specifically detects CES7 in Human samples. It is validated for Western Blot.Specifications
CES7 | |
Polyclonal | |
Rabbit | |
carboxylesterase 5A, carboxylesterase 7, CAUXIN, FLJ31547 | |
CES5A | |
IgG | |
58 kDa |
Western Blot | |
Unconjugated | |
RUO | |
221223 | |
Synthetic peptides corresponding to CES7(carboxylesterase 7) The peptide sequence was selected from the middle region of CES7. Peptide sequence LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title