Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CESK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CESK1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CESK1 Polyclonal specifically detects CESK1 in Human samples. It is validated for Western Blot.Specifications
CESK1 | |
Polyclonal | |
Rabbit | |
Q96SF2 | |
150160 | |
Synthetic peptide directed towards the middle region of human CCT8L2 (NP_055221). Peptide sequence AGINVAVVLGEVDEETLTLADKYGIVVIQARSWMEIIYLSEVLDTPLLPR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CESK1MGC118839, chaperonin containing TCP1, subunit 8 (theta)-like 2, MGC118840, putative T-complex protein 1 subunit theta-like 2, T-complex protein 1 | |
CCT8L2 | |
IgG | |
59 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title