CHD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP257564

Catalog No. NBP257564

Description

CHD3 Polyclonal specifically detects CHD3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CHD3
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: ATP-dependent helicase CHD3, CHD-3, chromodomain helicase DNA binding protein 3, chromodomain-helicase-DNA-binding protein 3, EC 3.6.1, EC 3.6.4.12, hZFH, Mi-2 autoantigen 240 kDa protein, Mi-2a, Mi2-ALPHA, ZFH, Zinc finger helicase, zinc-finger helicase (Snf2-like)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CHD3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('PAPSEKGEGIRTPLEKEEAENQEEKPEKNSRIGEKMETEADAPSPAPSLGERLEPRKIPLEDEVPGVPGEMEPEPGYRGDREKSATESTPGERGEEKPLDG',)
• Quantity: 100 μL
• Research Discipline: Immune Dysfunction, Immune System Diseases, Immunology
• Gene ID (Entrez): 1107
• Target Species: Human
• Isotype: IgG

For Research Use Only