Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHD5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00

Specifications

Antigen	CHD5
Dilution	Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB395810 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP24918625UL	25 μL	Each of 1 for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CHD5 Polyclonal antibody specifically detects CHD5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	CHD5
Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Chromatin Modifiers
Formulation	PBS (pH 7.2), 40% Glycerol
Gene ID (Entrez)	26038
Isotype	IgG
Purification Method	Immunogen affinity purified

Dilution	Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	ATP-dependent helicase CHD5, CHD-5, chromodomain helicase DNA binding protein 5, chromodomain-helicase-DNA-binding protein 5, DKFZp434N231, EC 3.6.1, EC 3.6.4.12, KIAA0444
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: GYMDEKDPGAQKPRQPLEVQALPAALDRVESEDKHESPASKERAREERPEETEKAPPSPEQLPREEVLPEKEKILDKLELSLIHSR
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CHD5 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents