Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHERP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18045720UL
Description
CHERP Polyclonal specifically detects CHERP in Human samples. It is validated for Western Blot.Specifications
| CHERP | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_006378 | |
| CHERP | |
| Synthetic peptide directed towards the middle region of human CHERP. Peptide sequence EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| calcium homeostasis endoplasmic reticulum protein, DAN16, DAN26, ERPROT 213-21, ERPROT213-21, protein with polyglutamine repeat, SCAF6, SRA1, SR-related CTD associated factor 6, SR-related CTD-associated factor 6 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 10523 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction