Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHIC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | CHIC2 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15995520
![]() |
Novus Biologicals
NBP15995520UL |
20 μL |
Each for $206.00
|
|
|||||
NBP159955
![]() |
Novus Biologicals
NBP159955 |
100 μL |
Each for $487.50
|
|
|||||
Description
CHIC2 Polyclonal specifically detects CHIC2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CHIC2 | |
Polyclonal | |
Rabbit | |
Q9UKJ5 | |
26511 | |
Synthetic peptides corresponding to CHIC2(cysteine-rich hydrophobic domain 2) The peptide sequence was selected from the N terminal of CHIC2. Peptide sequence EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI. | |
Primary |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
BTLBrX-like translocated in leukemia, cysteine-rich hydrophobic domain 2, cysteine-rich hydrophobic domain 2 protein, cystein-rich hydrophobic domain 2, MGC21173 | |
CHIC2 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title