Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHIC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	CHIC2
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15995520 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15995520UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP159955 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP159955	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CHIC2 Polyclonal specifically detects CHIC2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	CHIC2
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9UKJ5
Gene ID (Entrez)	26511
Immunogen	Synthetic peptides corresponding to CHIC2(cysteine-rich hydrophobic domain 2) The peptide sequence was selected from the N terminal of CHIC2. Peptide sequence EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI.
Primary or Secondary	Primary

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	BTLBrX-like translocated in leukemia, cysteine-rich hydrophobic domain 2, cysteine-rich hydrophobic domain 2 protein, cystein-rich hydrophobic domain 2, MGC21173
Gene Symbols	CHIC2
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CHIC2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents