Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                Chimaerin 2 Antibody, Novus Biologicals™
 
                                
                                
                                
                                
                            
                            
                            
                                
                                    
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Chimaerin 2 | 
|---|---|
| Applications | Western Blot | 
| Classification | Polyclonal | 
| Conjugate | Unconjugated | 
| Host Species | Rabbit | 
Description
Chimaerin 2 Polyclonal specifically detects Chimaerin 2 in Human samples. It is validated for Western Blot.Specifications
| Chimaerin 2 | |
| Polyclonal | |
| Rabbit | |
| ARHGAP3beta chimerin, BCH, beta-chimaerin, beta-chimerin, chimerin (chimaerin) 2, MGC138360, Rho GTPase-activating protein 3, RhoGAP3, rho-GTPase-activating protein 3 | |
| CHN2 | |
| IgG | |
| 38 kDa | 
| Western Blot | |
| Unconjugated | |
| RUO | |
| 1124 | |
| Synthetic peptides corresponding to CHN2(chimerin (chimaerin) 2) The peptide sequence was selected from the N terminal of CHN2. Peptide sequence NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC. | |
| Primary | 
Spot an opportunity for improvement?Share a Content Correction
            
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
			
            