Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Chimaerin 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Chimaerin 2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Chimaerin 2 Polyclonal specifically detects Chimaerin 2 in Human samples. It is validated for Western Blot.Specifications
Chimaerin 2 | |
Polyclonal | |
Rabbit | |
ARHGAP3beta chimerin, BCH, beta-chimaerin, beta-chimerin, chimerin (chimaerin) 2, MGC138360, Rho GTPase-activating protein 3, RhoGAP3, rho-GTPase-activating protein 3 | |
CHN2 | |
IgG | |
38 kDa |
Western Blot | |
Unconjugated | |
RUO | |
1124 | |
Synthetic peptides corresponding to CHN2(chimerin (chimaerin) 2) The peptide sequence was selected from the N terminal of CHN2. Peptide sequence NHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIAQGVRCSDCGLNVHKQC. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title