Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHIP/STUB1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | CHIP/STUB1 |
|---|---|
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CHIP/STUB1 Polyclonal specifically detects CHIP/STUB1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| CHIP/STUB1 | |
| Polyclonal | |
| Rabbit | |
| Neuroscience | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 10273 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQ | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Antigen NY-CO-7, Carboxy terminus of Hsp70-interacting protein, CHIPSTIP1 homology and U box-containing protein 1, CLL-associated antigen KW-8, E3 ubiquitin-protein ligase CHIP, EC 6.3.2.-, heat shock protein A binding protein 2 (c-terminal), HSPABP2, NY-CO-7, SDCCAG7, serologically defined colon cancer antigen 7, STIP1 homology and U-box containing protein 1, STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase, UBOX1 | |
| STUB1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title