Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ CHK2 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA579041
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Spleen Tissue, Mouse Testis Tissue, SW620 whole cell. IHC: human lung cancer tissue.
CHEK2 (CHK2) is a serine/threonine kinase and a component of the DNA damage checkpoint pathway. A mutation in CHK2 has been linked to cancer. CHK2 is activated by DNA damage and phosphorylates several modulators of cell cycle control including tumor suppressor proteins. In addition, Chk2 can phosphorylate BRCA1, allowing BRCA1 to restore survival after DNA damage. Chk2 is a putative tumor suppressor protein, with mutations in to the Chk2 gene linked to Li-Fraumeni syndrome, a familiar cancer usually associated with inherited mutations in TP53. Also, mutations in CHK2 are thought to confer a predisposition to sarcomas, breast cancer, and brain tumors.
Specifications
CHK2 | |
Polyclonal | |
Unconjugated | |
Chek2 | |
CDS1; cds1 homolog; Checkpoint kinase 2; Checkpoint like protein CHK2; checkpoint-like protein CHK2; Chek2; Chk2; Chk2 (phospho T68); Chk2 (pThr68); CHK2 checkpoint homolog; CHK2 checkpoint homolog (S. pombe); Chk2 phospho; Chk2 phospho T68; del9; EC 2.7.11.1; hCds1; HuCds 1; HuCds1; kinase Chk2; LFS2; OTTHUMP00000199044; OTTHUMP00000199045; OTTHUMP00000199064; OTTHUMP00000199115; OTTHUMP00000199116; phospho Chk2 (T68); phospho Thr68 Chk2; PP1425; protein kinase Chk2; Rad53; Rad53 homolog; RP11-436C9.1; Serine/threonine protein kinase Chk2; serine/threonine-protein kinase Chk2 | |
Rabbit | |
Antigen affinity chromatography | |
RUO | |
11200, 114212, 50883 | |
-20°C | |
Lyophilized |
Immunohistochemistry (Paraffin), Western Blot | |
500 μg/mL | |
PBS with 5mg BSA and 0.05mg sodium azide | |
O96017, Q9Z265 | |
Chek2 | |
A synthetic peptide corresponding to a sequence at the C-terminus of human Chk2 (465-498aa KLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDL). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction