Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHML Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | CHML |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CHML Polyclonal specifically detects CHML in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
CHML | |
Polyclonal | |
Rabbit | |
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
1122 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: LEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITY | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
Human | |
Choroideraemia-like protein, choroideremia-like (Rab escort protein 2), FLJ10071, Rab escort protein 2, rab proteins geranylgeranyltransferase component A 2, REP-2, REP-2, Rab escort protein 2, REP2FLJ13361 | |
CHML | |
IgG | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title