Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cholecystokinin-B R/CCKBR Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP324739
Description
Cholecystokinin-B R/CCKBR Polyclonal antibody specifically detects Cholecystokinin-B R/CCKBR in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
Cholecystokinin-B R/CCKBR | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
CCK2 receptor, CCK2R, CCK2-R, CCK-B, CCK-B receptor, CCK-BR, CCKRB, cholecystokinin B receptor, Cholecystokinin-2 receptor, cholecystokinin-B receptor/gastrin receptor, GASR, gastrin receptor, gastrin/cholecystokinin type B receptor | |
This antibody has been engineered to specifically recognize the recombinant protein Cholecystokinin-B R/CCKBR using the following amino acid sequence: FMHRRFRQACLETCARCCPRPPRARPRALPDEDPPTPSIASLSRLSYTTISTLGP | |
100 μL | |
Cell Cycle and Replication, GPCR, Signal Transduction | |
887 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunocytochemistry | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction