Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Choline dehydrogenase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP238842
Description
Choline dehydrogenase Polyclonal specifically detects Choline dehydrogenase in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Choline dehydrogenase | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
Q8NE62 | |
CHDH | |
This antibody was developed against a recombinant protein corresponding to amino acids: RKVCIGLEWLWKFTGEGATAHLETGGFIRSQPGVPHPDIQFHFLPSQVIDHGRVPTQQEAYQVHVGPMRGTSVGWLKLRSANPQDHPVI | |
0.1 mL | |
Lipid and Metabolism | |
55349 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CDH, CHD, choline dehydrogenase, choline dehydrogenase, mitochondrial, EC 1.1.99.1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction