Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Chondroadherin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Chondroadherin |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Chondroadherin Polyclonal specifically detects Chondroadherin in Human samples. It is validated for Western Blot.Specifications
Chondroadherin | |
Polyclonal | |
Rabbit | |
O15335 | |
1101 | |
Synthetic peptides corresponding to CHAD(chondroadherin) The peptide sequence was selected from the middle region of Chondroadherin. Peptide sequence LSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chondroadherin, chondroadherin proteoglycan, SLRR4ACartilage leucine-rich protein | |
CHAD | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title