Chondromodulin-1/LECT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159348

Catalog No. NBP159348

Description

Chondromodulin-1/LECT1 Polyclonal specifically detects Chondromodulin-1/LECT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Chondromodulin-1/LECT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BRICD3, BRICHOS domain containing 3, CHM1chondromodulin I, ChM-I, CHMI, chondromodulin, chondromodulin-1, Chondromodulin-I, leukocyte cell derived chemotaxin 1, Leukocyte cell-derived chemotaxin 1, multiple myeloma tumor suppressor 1, MYETS1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O75829
• Gene Symbols: LECT1
• Immunogen: Synthetic peptides corresponding to LECT1(leukocyte cell derived chemotaxin 1) The peptide sequence was selected from the N terminal of LECT1. Peptide sequence AIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGK.
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 11061
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only