Learn More
Novus Biologicals™ Chorionic Gonadotropin beta Chain (HCG beta) Recombinant Protein Antigen
Shop All R&D Systems Products

Description
Specifications
Specifications
| Protein Length | PTMTRVLQGVLPALPQVVCNYRDVRFESIRLP |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | CGB Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4 |
| For Use With (Application) | AC |
| Gene Alias | CGB, CGB3, CGB3choriogonadotropin subunit beta, CGB5, CGB7, CGB8, CG-Beta |
| Gene Symbol | CGB3 |
| Label Type | Unlabeled |
| Molecular Weight (g/mol) | 21 kDa |
| Show More |
For Research Use Only.
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.