Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHRFAM7A Antibody, Novus Biologicals™
SDP

Catalog No. NBP180090 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP180090 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP180090 Supplier Novus Biologicals Supplier No. NBP180090
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CHRFAM7A Polyclonal specifically detects CHRFAM7A in Human samples. It is validated for Western Blot.

Specifications

Antigen CHRFAM7A
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_683709
Gene Alias CHRNA7, CHRNA7 (cholinergic receptor, nicotinic, alpha 7, exons 5-10) and FAM7A (familywith sequence similarity 7A, exons A-E) fusion, CHRNA7 (cholinergic receptor, nicotinic, alpha polypeptide 7, exons 5-10) andFAM7A (family with sequence similarity 7A, exons A-E) fusion, CHRNA7-DR1alpha 7 neuronal nicotinic acetylcholine receptor-FAM7A hybrid, CHRNA7-FAM7A fusion protein, D-10alpha-7 nicotinic cholinergic receptor subunit, MGC120482, MGC120483
Gene Symbols CHRFAM7A
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human CHRFAM7A. Peptide Sequence: QRRCSLASVEMSAVAPPPASNGNLLYIGFRGLDGVHCVPTPDSGVVCGRM
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 89832
Test Specificity Expected identity based on immunogen sequence: Mouse: 100%; Human: 100%; Rhesus macaque: 100%; Rat: 100%; Bovine: 92%; Pig: 92%; Herring gull: 92%; Common quail: 92%; Chicken: 92%; Zebrafish: 91%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.