Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHRNB3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17995020UL
Description
CHRNB3 Polyclonal specifically detects CHRNB3 in Human samples. It is validated for Western Blot.Specifications
CHRNB3 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_000740 | |
CHRNB3 | |
Synthetic peptide directed towards the middle region of human CHRNB3The immunogen for this antibody is CHRNB3. Peptide sequence YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY. | |
Affinity Purified | |
RUO | |
1142 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
acetylcholine receptor, neuronal nicotinic, beta-3 subunit, cholinergic receptor, nicotinic, beta 3, cholinergic receptor, nicotinic, beta polypeptide 3, neuronal acetylcholine receptor subunit beta-3 | |
Rabbit | |
53 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction