Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHRNB3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | CHRNB3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17995020
|
Novus Biologicals
NBP17995020UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179950
|
Novus Biologicals
NBP179950 |
100 μL |
Each for $487.50
|
|
|||||
Description
CHRNB3 Polyclonal specifically detects CHRNB3 in Human samples. It is validated for Western Blot.Specifications
| CHRNB3 | |
| Polyclonal | |
| Rabbit | |
| NP_000740 | |
| 1142 | |
| Synthetic peptide directed towards the middle region of human CHRNB3The immunogen for this antibody is CHRNB3. Peptide sequence YDGTMVDLILINENVDRKDFFDNGEWEILNAKGMKGNRRDGVYSYPFITY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| acetylcholine receptor, neuronal nicotinic, beta-3 subunit, cholinergic receptor, nicotinic, beta 3, cholinergic receptor, nicotinic, beta polypeptide 3, neuronal acetylcholine receptor subunit beta-3 | |
| CHRNB3 | |
| IgG | |
| 53 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title