Chromogranin C Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26269325UL

Catalog No. NB393039

Description

Chromogranin C Polyclonal antibody specifically detects Chromogranin C in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Chromogranin C
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000
• Gene Alias: CHCG, Chromogranin-C, EM66, SCG2, secretogranin IICHGCchromogranin-C, secretoneurin, SgIIsecretogranin-2, SN
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NPVEEKIESQTQEEVRDSKENIEKNEQINDEMKRSGQLGIQEEDLRKESKDQLSDDVSKVIAYLKRLVNAAGSGRLQNGQNGERA
• Quantity: 25 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 7857
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified