CHST14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25738925UL

Catalog No. NB393991

Description

CHST14 Polyclonal specifically detects CHST14 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CHST14
• Classification: Polyclonal
• Dilution: Western Blot 1:250 - 1:500, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: ATCS, carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 14, D4ST-1, D4ST1carbohydrate sulfotransferase 14, dermatan 4 sulfotransferase 1, Dermatan 4-sulfotransferase 1, EC 2.8.2.-, HD4ST, hD4ST1, HNK1ST
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CHST14
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GILAEMKPLPLHPPGREGTAWRGKAPKPGGLSLRAGDADLQVRQDVRNRTLRAVCGQPGMPRDPWDLPV
• Quantity: 25 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 113189
• Target Species: Human
• Form: Purified

For Research Use Only