Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHTF18 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157605
Description
CHTF18 Polyclonal specifically detects CHTF18 in Human samples. It is validated for Western Blot.Specifications
CHTF18 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
C16orf41, C321D2.2, C321D2.3, C321D2.3 (novel protein), C321D2.4 (novel protein), CHL12C321D2.4, chromosome 16 open reading frame 41, chromosome transmission fidelity protein 18 homolog, CTF18, CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae), EC 3.6.1, hCTF18, homolog of yeast CHL12, RUVBL, some homology with holliday junction DNA helicase RUVB like | |
Rabbit | |
Affinity purified | |
RUO | |
63922 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8WVB6 | |
CHTF18 | |
Synthetic peptides corresponding to CHTF18 (CTF18, chromosome transmission fidelity factor 18 homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of CHTF18)(50ug). Peptide sequence QALLLDALCLLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYR The peptide sequence for this immunogen was taken from within the described region. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Human: 100%; Mouse: 100%; Bovine: 92%; Chicken: 92%; Guinea pig: 92%; Equine: 92%; Rat: 92%; Zebrafish: 83%. | |
Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Zebrafish | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction