Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CHTOP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$405.00 - $670.00
Specifications
| Antigen | CHTOP |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
CHTOP Polyclonal specifically detects CHTOP in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.Specifications
| CHTOP | |
| Polyclonal | |
| Rabbit | |
| Human | |
| C1orf77, chromatin target of PRMT1, DKFZp547E1010, FOPMGC86949, Friend of PRMT1 protein, MGC131924, pp7704, RP1-178F15.2, Small arginine- and glycine-rich protein, small protein rich in arginine and glycine, SRAGchromosome 1 open reading frame 77 | |
| CHTOP | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 26097 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:GRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title