Chymase/CMA1/Mast Cell Chymase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Catalog Number	Mfr. No.	Quantity
NB436797	Novus Biologicals NBP23366025UL	25 μL
NBP233660	Novus Biologicals NBP233660	0.1 mL

Description

Chymase/CMA1/Mast Cell Chymase Polyclonal specifically detects Chymase/CMA1/Mast Cell Chymase in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Chymase/CMA1/Mast Cell Chymase
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: P23946
• Gene ID (Entrez): 1215
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cell Biology, Cytoskeleton Markers, Immunology, Innate Immunity, Mast Cell Markers
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891
• Gene Symbols: CMA1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only