Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Chymase/CMA1/Mast Cell Chymase Rabbit anti-Human, Mouse, Rat, Clone: 2O4P8, Novus Biologicals™

Rabbit Monoclonal Antibody
Supplier: Novus Biologicals NBP31538920UL
This item is not returnable.
View return policy
Description
Chymase/CMA1/Mast Cell Chymase Monoclonal antibody specifically detects Chymase/CMA1/Mast Cell Chymase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
Chymase/CMA1/Mast Cell Chymase | |
Monoclonal | |
Unconjugated | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Mouse, Rat | |
Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
2O4P8 | |
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
Alpha-chymase, chymase, chymase 1 preproprotein transcript E, chymase 1 preproprotein transcript I, chymase 1, mast cell, chymase, heart, chymase, mast cell, CYH, CYM, EC 3.4.21, EC 3.4.21.39, Mast cell protease I, MCT1, MGC119890, MGC119891 | |
A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Chymase/CMA1/Mast Cell Chymase (CMA1) (P23946). GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN | |
20 μg | |
Cell Biology, Cellular Markers, Immunology, Innate Immunity, Mast Cell Markers | |
1215 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction