CIN85/SH3KBP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157065

Catalog No. NBP157065

Description

CIN85/SH3KBP1 Polyclonal specifically detects CIN85/SH3KBP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CIN85/SH3KBP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: c-Cbl-interacting protein, CD2-binding protein 3, CD2BP3, CIN85Cbl-interacting protein of 85 kDa, GIG10, HSB1, HSB-1, Human Src family kinase-binding protein 1, MIG18, migration-inducing gene 18, SH3 domain-containing kinase-binding protein 1, SH3-domain kinase binding protein 1, Src family kinase-binding protein 1, src-related kinase binding protein-1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 30011
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Accession No.: Q5JPT5
• Gene Symbols: SH3KBP1
• Immunogen: Synthetic peptides corresponding to SH3KBP1 (SH3-domain kinase binding protein 1) The peptide sequence was selected from the N terminal of SH3KBP1. Peptide sequence TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 91%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG