Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CIN85/SH3KBP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | CIN85/SH3KBP1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157065
|
Novus Biologicals
NBP157065 |
100 μL |
Each for $436.00
|
|
NBP15706520
|
Novus Biologicals
NBP15706520UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
CIN85/SH3KBP1 Polyclonal specifically detects CIN85/SH3KBP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| CIN85/SH3KBP1 | |
| Unconjugated | |
| RUO | |
| Q5JPT5 | |
| 30011 | |
| Synthetic peptides corresponding to SH3KBP1 (SH3-domain kinase binding protein 1) The peptide sequence was selected from the N terminal of SH3KBP1. Peptide sequence TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| c-Cbl-interacting protein, CD2-binding protein 3, CD2BP3, CIN85Cbl-interacting protein of 85 kDa, GIG10, HSB1, HSB-1, Human Src family kinase-binding protein 1, MIG18, migration-inducing gene 18, SH3 domain-containing kinase-binding protein 1, SH3-domain kinase binding protein 1, Src family kinase-binding protein 1, src-related kinase binding protein-1 | |
| SH3KBP1 | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title