Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CIN85/SH3KBP1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen CIN85/SH3KBP1
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
Regulatory Status RUO
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP157065
View Documents
Novus Biologicals
NBP157065
100 μL
Each for $436.00
Add to cart
 
NBP15706520
View Documents
Novus Biologicals
NBP15706520UL
20 μL This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. N/A
Description

Description

CIN85/SH3KBP1 Polyclonal specifically detects CIN85/SH3KBP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications

Specifications

CIN85/SH3KBP1
Unconjugated
RUO
Q5JPT5
30011
Synthetic peptides corresponding to SH3KBP1 (SH3-domain kinase binding protein 1) The peptide sequence was selected from the N terminal of SH3KBP1. Peptide sequence TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Rabbit
PBS and 2% Sucrose with 0.09% Sodium Azide
c-Cbl-interacting protein, CD2-binding protein 3, CD2BP3, CIN85Cbl-interacting protein of 85 kDa, GIG10, HSB1, HSB-1, Human Src family kinase-binding protein 1, MIG18, migration-inducing gene 18, SH3 domain-containing kinase-binding protein 1, SH3-domain kinase binding protein 1, Src family kinase-binding protein 1, src-related kinase binding protein-1
SH3KBP1
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit