CISD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159676

Catalog No. NBP159676

Description

CISD2 Polyclonal specifically detects CISD2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CISD2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CDGSH iron sulfur domain 2, CDGSH iron-sulfur domain-containing protein 2, CDGSH2, Endoplasmic reticulum intermembrane small protein, ERISWFS2, Miner1Wolfram syndrome 2, mitoNEET related 1, MitoNEET-related 1 protein, NAF-1, Nutrient-deprivation autophagy factor-1, ZCD2CDGSH iron sulfur domain-containing protein 2, zinc finger, CDGSH-type domain 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 15 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N5K1
• Gene Symbols: CISD2
• Immunogen: Synthetic peptides corresponding to CISD2(CDGSH iron sulfur domain 2) The peptide sequence was selected from the N terminal of CISD2. Peptide sequence VLESVARIVKVQLPAYLKRLPVPESITGFARLTVSEWLRLLPFLGVLALL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 493856
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only