Invitrogen™ CK1 alpha Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579077

Catalog No. PIPA579077

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Rat Kidney Tissue, Mouse Kidney Tissue, HELA whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue.

CNSK1A1 (CK1 alpha 1) is a member of the casein kinase I (CKI) gene family, which encodes serine/threonine kinases that preferentially phosphorylate acidic substrates. CKI proteins are monomeric, ranging from 25 to 55 kD, and are found in the nuclei, cytoplasm, and membrane fractions of eukaryotic cells. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis.

Specifications

• Antigen: CK1 alpha
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: CSNK1A1
• Gene Alias: 2610208K14Rik; 4632404G05Rik; 5430427P18Rik; casein kinase 1 alpha 1; casein kinase 1 alpha 1 like; casein kinase 1 alpha 1 S homeolog; casein kinase 1 alpha 1 S homeolog; casein kinase 1, alpha 1; casein kinase 1 alpha isoform; casein kinase 1, alpha 1; casein kinase 1alpha S; casein kinase 1-alphaL; casein kinase 1-alphaLS; casein kinase I; casein kinase I alpha; casein kinase I alpha L isoform; casein kinase I alpha LS; casein kinase I alpha S; Casein kinase I isoform alpha; casein kinase I isoform alpha; casein kinase I; casein kinase I-alpha; CHUNP6894; CK I alpha; CK1; ck1 alpha; CK1a; ck1alpha; CK1alphaS; CKI alpha; CK-I alpha; CKIa; CKI-alpha; clock regulator kinase; Csnk1a; csnk1a1; CSNK1A1 protein; csnk1a1.S; CSNK1A1/CK1; CSNK1A1L; down-regulated in lung cancer; epididymis secretory sperm binding protein Li 77p; HEL-S-77p; HLCDGP1; OTTHUMP00000224000; OTTHUMP00000224001; OTTHUMP00000224003; PRO2975; protein kinase; sb:eu866; wu:fb65a02; wu:fi30h04; wu:fj19c11; XELAEV_18021437mg; YIL035C; zgc:92158
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 113927, 1452, 93687
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P48729, P97633, Q8BK63
• Gene Symbols: CSNK1A1
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov