Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA579077

Invitrogen™ CK1 alpha Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579077
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579077 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579077 Supplier Invitrogen™ Supplier No. PA579077
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Rat Kidney Tissue, Mouse Kidney Tissue, HELA whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue.

CNSK1A1 (CK1 alpha 1) is a member of the casein kinase I (CKI) gene family, which encodes serine/threonine kinases that preferentially phosphorylate acidic substrates. CKI proteins are monomeric, ranging from 25 to 55 kD, and are found in the nuclei, cytoplasm, and membrane fractions of eukaryotic cells. It can phosphorylate a large number of proteins. Participates in Wnt signaling. Phosphorylates CTNNB1 at 'Ser-45'. May phosphorylate PER1 and PER2. May play a role in segregating chromosomes during mitosis.
TRUSTED_SUSTAINABILITY

Specifications

Antigen CK1 alpha
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene CSNK1A1
Gene Accession No. P48729, P97633, Q8BK63
Gene Alias 2610208K14Rik; 4632404G05Rik; 5430427P18Rik; casein kinase 1 alpha 1; casein kinase 1 alpha 1 like; casein kinase 1 alpha 1 S homeolog; casein kinase 1 alpha 1 S homeolog; casein kinase 1, alpha 1; casein kinase 1 alpha isoform; casein kinase 1, alpha 1; casein kinase 1alpha S; casein kinase 1-alphaL; casein kinase 1-alphaLS; casein kinase I; casein kinase I alpha; casein kinase I alpha L isoform; casein kinase I alpha LS; casein kinase I alpha S; Casein kinase I isoform alpha; casein kinase I isoform alpha; casein kinase I; casein kinase I-alpha; CHUNP6894; CK I alpha; CK1; ck1 alpha; CK1a; ck1alpha; CK1alphaS; CKI alpha; CK-I alpha; CKIa; CKI-alpha; clock regulator kinase; Csnk1a; csnk1a1; CSNK1A1 protein; csnk1a1.S; CSNK1A1/CK1; CSNK1A1L; down-regulated in lung cancer; epididymis secretory sperm binding protein Li 77p; HEL-S-77p; HLCDGP1; OTTHUMP00000224000; OTTHUMP00000224001; OTTHUMP00000224003; PRO2975; protein kinase; sb:eu866; wu:fb65a02; wu:fi30h04; wu:fj19c11; XELAEV_18021437mg; YIL035C; zgc:92158
Gene Symbols CSNK1A1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 113927, 1452, 93687
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.