Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CKII alpha prime polypeptide Antibody [mFluor Violet 610 SE], Novus Biologicals Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP335650MFV610
Description
CKII alpha prime polypeptide Polyclonal antibody specifically detects CKII alpha prime polypeptide in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/ ImmunofluorescenceSpecifications
| CKII alpha prime polypeptide | |
| Polyclonal | |
| 50mM Sodium Borate | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| mFluor Violet 610 SE | |
| casein kinase 2, alpha prime polypeptide, casein kinase II subunit alpha', CK II alpha', CK2A2, CSNK2A1, EC 2.7.11, EC 2.7.11.1, FLJ43934 | |
| A synthetic peptide corresponding to a sequence within amino acids 250-350 of human CKII alpha prime polypeptide (NP_001887.1).,, Sequence:, LGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR | |
| 0.1 mL | |
| Protein Kinase, Wnt Signaling Pathway | |
| 1459 | |
| Store at 4°C in the dark. | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction