CKMT2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154661

Catalog No. NBP154661

Description

CKMT2 Polyclonal specifically detects CKMT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CKMT2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Basic-type mitochondrial creatine kinase, creatine kinase S-type, mitochondrial, creatine kinase, mitochondrial 2 (sarcomeric), EC 2.7.3, EC 2.7.3.2, mib-CK, Sarcomeric mitochondrial creatine kinase, S-MtCK, SMTCK
• Host Species: Rabbit
• Molecular Weight of Antigen: 46 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: P17540
• Gene Symbols: CKMT2
• Immunogen: Synthetic peptides corresponding to CKMT2(creatine kinase, mitochondrial 2 (sarcomeric)) The peptide sequence was selected from the N terminal of CKMT2 (NP_001816). Peptide sequence GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1160
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

For Research Use Only