Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CKS2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | CKS2 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CKS2 Polyclonal specifically detects CKS2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
CKS2 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication, Core ESC Like Genes, Mitotic Regulators, Stem Cell Markers | |
CDC28 protein kinase 2, CDC28 protein kinase regulatory subunit 2, CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2, CKS-2, CKSHS2, cyclin-dependent kinases regulatory subunit 2 | |
CKS2 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
1164 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title