CL-P1/COLEC12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25882625UL

Catalog No. NB393258

Description

CL-P1/COLEC12 Polyclonal specifically detects CL-P1/COLEC12 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: CL-P1/COLEC12
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: CL-P1, CLP1hCL-P1, collectin placenta 1, Collectin placenta protein 1, collectin sub-family member 12, collectin-12, Nurse cell scavenger receptor 2, SCARA4NSR2, Scavenger receptor class A member 4, scavenger receptor class A, member 4, SRCLScavenger receptor with C-type lectin
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 81035
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: COLEC12
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GYKVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQ
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only