Clathrin light chain + heavy chain Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169194

Catalog No. NBP169194

Description

Clathrin light chain + heavy chain Polyclonal specifically detects Clathrin light chain + heavy chain in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Clathrin light chain + heavy chain
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CLTA
• Immunogen: Synthetic peptides corresponding to CLTA (clathrin, light chain (Lca)) The peptide sequence was selected from the C terminal of CLTA. Peptide sequence KELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTEWERVARLCDF.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Zebrafish: 75%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Gene Alias: clathrin light chain A, clathrin, light chain A, LCA, light polypeptide (Lca)
• Host Species: Rabbit
• Molecular Weight of Antigen: 24 kDa
• Quantity: 100 μL
• Research Discipline: Membrane Trafficking and Chaperones, Membrane Vesicle Markers
• Gene ID (Entrez): 1211
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.